Hormona liberadora de hormona adrenocorticotropa

De Wikipedia, la enciclopedia libre
Ir a la navegación Ir a la búsqueda
Hormona liberadora de hormona adrenocorticotropa
PBB Protein CRH image.jpg
Estructuras disponibles
PDB Buscar ortólogos: PDBe, RCSB
Identificadores
Símbolo CRH (HGNC: 2355)
Identificadores
externos
Locus Cr. 8 q13
Ortólogos
Especies
Humano Ratón
Entrez
1392
UniProt
P06850 n/a
RefSeq
(ARNm)
NM_000756 n/a
Neuronas CRH (abajo derecha) dentro del Núcleo Paraventricular (arriba). Inmunohistoquímica.

La hormona liberadora de corticotropina,[1]​ (CRH en inglés), hormona liberadora de hormona adrenocorticotropa, también llamada corticoliberina y antiguamente factor liberador de corticotropina (CRF en inglés), es un neuropéptido secretado por las neuronas del núcleo paraventricular del hipotálamo.[2]​ Esta hormona estimula las células corticotropas de la cercana adenohipófisis, para la secreción de la ACTH.[3]
La hormona liberadora CRH tiene un efecto clave sobre la coordinación de la respuesta neuroendocrina, la respuesta inmune y la respuesta comportamental frente al estrés.[4]

Estructura[editar]

La hormona liberadora de hormona adrenocorticotropa (CRH)[1]​ se sintetiza a partir de un precursor de 196 aminoácidos llamado pre-proCRH. Luego de una escisión, se obtiene la prohormona proCRH que tiene 170 aminoácidos desde la posición 25 a 194.
La CRH humana madura y biológicamente activa es un neuropéptido de 41 aminoácidos, su estructura primaria, representada mediante el sistema de nomenclatura de aminoácidos de una sola letra, es la siguiente:[5][6]

SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

Esto sucede dentro de las células CRH parvocelulares, de la porción anterior del Núcleo paraventricular en el hipotálamo ventro-medial.[7]

La CRH Tiene una vida media plasmática de sesenta minutos y una masa molar de 5000 g/mol.[2]

Secreción[editar]

{{{Alt
ARNm de la CRH (en violeta) dentro de las células CRH del NPV humano. Hibridación in situ.

La hormona liberadora de hormona adrenocorticotropa (CRH),[1]​ antes conocida como factor liberador de corticotropina (CRF en inglés), es un neuropéptido secretado por las neuronas CRH del núcleo paraventricular (PVN) del hipotálamo.[2]
Las células CRH son neuronas secretoras especializadas, que extienden sus prolongaciones o procesos distales hasta la Eminencia media donde la CRH es liberada.

Sistema Porta hipotálamo-hipofisario.

La hormona CRH es liberada desde las neuronas CRH dentro de los vasos sanguíneos capilares del Sistema Porta hipotálamo-hipófisis que es la red sanguínea que se continúa a lo largo del tallo de la hipófisis, en un sistema de pequeñas vasos que llegan a la hipófisis anterior (adenohipófisis).

Efecto[editar]

A través del sistema vascular porta, la hormona liberadora de hormona adrenocorticotropa (CRH) actúa sobre las células Corticotropas de la adenohipófisis.
En la membrana plasmática de las Corticotropas, la CRH se une a sus receptores (CRH-R).[8]​ Estos receptores, el CRH-R1 y el CRH-R2, acoplados a proteínas G, median el incremento en la síntesis de la ACTH (corticotropina) que es el fin último de la CRH.[9][10]

Distribución[editar]

La CRH es una neurohormona que está ampliamente distribuida en los circuitos extra-hipotalámicos del cerebro, donde funciona como un neuromodulador.[11]
Las neuronas secretoras de CRH se localizan también en la corteza cerebral, el sistema límbico y la médula espinal. Se piensa que tales ubicaciones representan la base de los efectos neurales producidos como respuesta al estrés, como la liberación de adrenalina y noradrenalina, taquicardia, hiperglucemia, hipertensión, entre otros.[7][12]
En los órganos y tejidos periféricos, la CRH tiene una función inmunomoduladora, y su efecto es pro-inflamatorio.[11]

Regulación[editar]

Regulación de la secreción de la CRH.
Esquema de la Regulación de CRH

La expresión de la hormona liberadora de adrenocorticotropica (CRH),[1]​ es estimulada por los estados de balance energético positivo y es reducida en estados de balance energético negativo, tales como la falta de alimentación. Los nutrientes que se encuentran en la sangre también afectan los niveles de expresión de la CRH, es decir, cuando los niveles de glucosa aumenta, los niveles de CRH disminuyen y ocurre lo contrario cuando los niveles de glucosa disminuyen. Otros factores que estimulan la liberación del factor liberador de corticotropina incluyen las catecolaminas y la vasopresina.[cita requerida]

La hormona antidiurética y la angiotensina II, por medio de esta hormona liberadora, potencian también la secreción de hormona adrenocorticotropa. También mediada por la CRH, la oxitocina inhibe la secreción de ACTH.[13]​ El efecto inhibidor de los glucocorticoides regula la secreción de la corticoliberina y también está regulada por las aferencias nerviosas que se localizan en el núcleo paraventricular.[9]

En las etapas finales del embarazo y durante el parto se elevan los niveles de este péptido, que también aumenta la actividad del sistema nervioso simpático, con lo que favorece la secreción de catecolaminas, y parece ser relevante en el equilibrio de energía[9][13]​ e incluso determinar la duración de la gestación.[14]

Familia de la CRH[editar]

Esquema 3D de la estructura secundaria de la Proteína de Unión (BP) a la CRF.
Imagen de la estructura secundaria de la Proteína de Unión (BP) luego de unida a la CRH.
Esquema 3D de la BP unida a la CRH.

La CRH pertenece a una Familia de proteínas que interactúan fuertemente entre sí y que incluye la CRH, dos diferentes receptores (CRH-R1 y CRH-R2), una proteína de unión a CRH (CRH-BP) y las urocortinas que son ligandos endógenos de los receptores CRH-R.
Hay tres urocortinas conocidas, identificadas como urocortina 1 (Ucn1), urocortina 2 (Ucn2) y urocortina 3 (Ucn3).
El CRF y las urocortinas interactúan con los receptores CRF-R1 y CRF-R2. La CRF y Unc1 se unen con alta afinidad al CRF-R1. Ucn2 y Ucn3, en cambio, se unen con una afinidad mucho más alta a CRFR2.
Se ha descrito también una proteína de unión a la corticoliberina (CRH-BP, por sus siglas en inglés), específica en suero y otros sitios intracelulares de varias células, que probablemente module sus acciones y vida media plasmática.[13][6][15]

Patología[editar]

Cuando el hipotálamo no produce suficiente Hormona liberadora de hormona adrenocorticotropa (CRH o factor CRF), entonces la vecina glándula Hipófisis no puede producir la ACTH necesaria y como consecuencia las glándulas suprarrenales no producen el suficiente cortisol para mantener la homeostasis diaria.[16]
Las alteraciones en la regulación del sistema CRH están incluidas en los trastornos relacionados con el estrés como: en las afecciones psiquiátricas (depresión, ansiedad, adicciones), en las alteraciones neuroendocrinológicas e inflamación, y en las enfermedades neurodegenerativas.[11][10]

Referencias[editar]

  1. a b c d OMS,OPS (ed.). «Hormona Liberadora de Corticotropina». Descriptores en Ciencias de la Salud, Biblioteca Virtual en SALUD. 
  2. a b c Córdoba Saucedo, Ulices; Navarro Zarza, José Eduardo; Durán Pérez, Edgar Gerardo; Peralta Calcaneo, Juan Antonio; Alexanderson Rosas, Elvira Graciela (2006). «Neurohormonas hipotalámicas: acciones biológicas y aplicaciones clínicas». Medicina Interna de México 22 (6): 514-524. Consultado el 5 de septiembre de 2019. 
  3. Melchitzky, Darlene S.; Austin, Mark C.; Lewis, David A. (2006). «3. Neuroanatomía química del cerebro del primate». En Alan F. Schatzberg y Charles B. Nemeroff, ed. Tratado de psicofarmacología. Barcelona: Masson. p. 89. ISBN 978-84-458-1426-0. 
  4. Bonfiglio J.J. (2013). Mecanismos moleculares involucrados en la señalización celular de la hormona CRH en el sistema nervioso central (Tesis). Universidad Nacional de Buenos Aires. Facultad de Ciencias Exactas y Naturales. 
  5. David A. Lovejoy (2005). «6: Osmorregulation, metabolism and Energy production, Neural circuitry associated with feeding». Neuroendocrinology: An Integrated Approach. John Wiley & Sons. p. 176. 
  6. a b Dedic, Nina; Chen, Alon; Deussing, Jan M. (2018). «The CRF Family of Neuropeptides and their Receptors - Mediators of the Central Stress Response.». Current molecular pharmacology (en inglés) 11 (1): 4-31. PMC 5930453. PMID 28260504. doi:10.2174/1874467210666170302104053. 
  7. a b Valero Politi, J. (1998). «61:Alteraciones hipotalámicas e hipofisarias». En X. Fuentes Arderiu, M.J. Castiñeiras Lacambra y J.M. Queraltó Compañó, ed. Bioquímica clínica y patología molecular II (Segunda edición). Barcelona: Editorial Reverté. p. 948. ISBN 84-291-1855-1. 
  8. OMS,OPS (ed.). «Receptores de Hormona Liberadora de Corticotropina». Descriptores en Ciencias de la Salud, Biblioteca Virtual en Salud. 
  9. a b c Farré Guerrero, V. (1998). «60. Alteraciones de la corteza suprarrenal». En X. Fuentes Arderiu, M. J. Castiñeiras Lacambra y J. M. Queraltó Compañó, ed. Bioquímica clínica y patología molecular II (Segunda edición). Barcelona: Editorial Reverté. p. 934. ISBN 84-291-1855-1. 
  10. a b Curley D.E.; Webb A.E.; Sheffler D.J.; Haass-Koffler C.L. (2021). «Corticotropin Releasing Factor Binding Protein as a Novel Target to Restore Brain Homeostasis: Lessons Learned From Alcohol Use Disorder Research». Frontiers in Behavioral Neuroscience (Revisión). Consultado el 21 de febrero de 2022. .
  11. a b c Inda C.; Armando N.G.; Dos Santos Claro P.A.; Silberstein S. (2017). «Endocrinology and the brain: corticotropin-releasing hormone signaling». Endocrine Connection 6 (6): R99-R120. Consultado el 19 de febrero de 2022. .
  12. González Bárcena, David; Velázquez Chávez, Francisco Javier; Tapia González, María de los Ángeles; Hernández Meza, Álvaro Rodolfo; Garnica Cuéllar, Juan Carlos; Alamilla Lugo, Lisndey; Muñoz Solís, Andrés; Sosa Caballero, Alejandro (2016). «5: Generalidades del hipotálamo y de la hipófisis». En Sociedad Mexicana de Nutrición y Endocrinología, ed. Endocrinología clínica de Dorantes y Martínez (5.ª edición). Ciudad de México: Médica Panamericana. p. 56. ISBN 978-607-448-558-5. 
  13. a b c Javorsky, Bradley R.; Aron, David C.; Findling, James W.; Tyrrell, J. Blake (2012). «4. Hipotálamo y glándula hipófisis». En David G. Gardner y Dolores Shoback, ed. Greenspan. Endocrinología básica y clínica (Novena edición). Ciudad de México: McGraw-Hill Interamericana. p. 73. ISBN 978-607-15-0669-6. 
  14. Kimball JW (15 de junio de 2006). «Hormones of the Hypothalamus». Kimball's Biology Pages 227 (5): 24-33. Bibcode:1972SciAm.227e..24G. PMID 4145789. doi:10.1038/scientificamerican1172-24. Archivado desde el original el 27 de junio de 2012. Consultado el 3 de agosto de 2008. 
  15. Slater P.G.; Gutiérrez-Maldonado S.E.; Gysling K.; Lagos C.F. (2018). «Molecular Modeling of Structures and Interaction of Human Corticotropin-Releasing Factor (CRF) Binding Protein and CRF Type-2 Receptor». Front. Endocrinol. (Frontiers (editorial)). Consultado el 21 de febrero de 2022. .
  16. «¿Qué es la insuficiencia suprarrenal? Insuficiencia suprarrenal terciaria.». NIDDK. NIH National Institutes of Health.